| Name | ACAA2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2493 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | ACAA2 antibody was raised using the N terminal of ACAA2 corresponding to a region with amino acids ALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETV |
| Purity/Format | Affinity purified |
| Blocking Peptide | ACAA2 Blocking Peptide |
| Description | Rabbit polyclonal ACAA2 antibody raised against the N terminal of ACAA2 |
| Gene | ACAA2 |
| Supplier Page | Shop |