Name | CLCNKB antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5147 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | CLCNKB antibody was raised using the C terminal of CLCNKB corresponding to a region with amino acids ILAAGCPTEPVTLKLSPETSLHEAHNLFELLNLHSLFVTSRGRAVGCVSW |
Purity/Format | Affinity purified |
Blocking Peptide | CLCNKB Blocking Peptide |
Description | Rabbit polyclonal CLCNKB antibody raised against the C terminal of CLCNKB |
Gene | CLCNKB |
Supplier Page | Shop |