FXYD5 antibody

Name FXYD5 antibody
Supplier Fitzgerald
Catalog 70R-6056
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen FXYD5 antibody was raised using the middle region of FXYD5 corresponding to a region with amino acids SERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLRKRGLLVAAVLFITG
Purity/Format Affinity purified
Blocking Peptide FXYD5 Blocking Peptide
Description Rabbit polyclonal FXYD5 antibody raised against the middle region of FXYD5
Gene FXYD5
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.