| Name | TRPC3 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5179 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | TRPC3 antibody was raised using the N terminal of TRPC3 corresponding to a region with amino acids MEGSPSLRRMTVMREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYG |
| Purity/Format | Affinity purified |
| Blocking Peptide | TRPC3 Blocking Peptide |
| Description | Rabbit polyclonal TRPC3 antibody raised against the n terminal of TRPC3 |
| Gene | TRP-TGG3-5 |
| Supplier Page | Shop |