Name | SCD antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1136 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | IHC WB |
Species Reactivities | Human |
Antigen | SCD antibody was raised using a synthetic peptide corresponding to a region with amino acids HPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWG |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | SCD Blocking Peptide |
Description | Rabbit polyclonal SCD antibody |
Gene | SCD |
Supplier Page | Shop |