| Name | CD160 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5801 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CD160 antibody was raised using the middle region of CD160 corresponding to a region with amino acids SGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEG |
| Purity/Format | Affinity purified |
| Blocking Peptide | CD160 Blocking Peptide |
| Description | Rabbit polyclonal CD160 antibody raised against the middle region of CD160 |
| Gene | CD160 |
| Supplier Page | Shop |