SULT1B1 antibody

Name SULT1B1 antibody
Supplier Fitzgerald
Catalog 70R-2335
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Dog
Antigen SULT1B1 antibody was raised using the N terminal of SULT1B1 corresponding to a region with amino acids KRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFW
Purity/Format Affinity purified
Blocking Peptide SULT1B1 Blocking Peptide
Description Rabbit polyclonal SULT1B1 antibody raised against the N terminal of SULT1B1
Gene SULT1B1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.