| Name | Complement C2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1657 |
| Prices | $315.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog, Zebrafish |
| Antigen | Complement C2 antibody was raised using the middle region of C2 corresponding to a region with amino acids INQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQ |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | Complement C2 Blocking Peptide |
| Description | Rabbit polyclonal Complement C2 antibody raised against the middle region of C2 |
| Gene | C2 |
| Supplier Page | Shop |