ALDOB antibody

Name ALDOB antibody
Supplier Fitzgerald
Catalog 70R-2209
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen ALDOB antibody was raised using the middle region of ALDOB corresponding to a region with amino acids KLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQ
Purity/Format Affinity purified
Blocking Peptide ALDOB Blocking Peptide
Description Rabbit polyclonal ALDOB antibody raised against the middle region of ALDOB
Gene ALDOB
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.