Name | ALDOB antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2209 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | ALDOB antibody was raised using the middle region of ALDOB corresponding to a region with amino acids KLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQ |
Purity/Format | Affinity purified |
Blocking Peptide | ALDOB Blocking Peptide |
Description | Rabbit polyclonal ALDOB antibody raised against the middle region of ALDOB |
Gene | ALDOB |
Supplier Page | Shop |