METTL6 antibody

Name METTL6 antibody
Supplier Fitzgerald
Catalog 70R-2973
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen METTL6 antibody was raised using the N terminal of METTL6 corresponding to a region with amino acids QKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTML
Purity/Format Affinity purified
Blocking Peptide METTL6 Blocking Peptide
Description Rabbit polyclonal METTL6 antibody raised against the N terminal of METTL6
Gene METTL6
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.