Carboxylesterase 7 antibody

Name Carboxylesterase 7 antibody
Supplier Fitzgerald
Catalog 70R-5468
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Carboxylesterase 7 antibody was raised using the N terminal of CES7 corresponding to a region with amino acids SGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSP
Purity/Format Affinity purified
Blocking Peptide Carboxylesterase 7 Blocking Peptide
Description Rabbit polyclonal Carboxylesterase 7 antibody raised against the N terminal of CES7
Gene CES5A
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.