| Name | PPP2R3B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5596 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PPP2R3B antibody was raised using a synthetic peptide corresponding to a region with amino acids ELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | PPP2R3B Blocking Peptide |
| Description | Rabbit polyclonal PPP2R3B antibody |
| Gene | PPP2R3B |
| Supplier Page | Shop |