| Name | LYN antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3701 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | LYN antibody was raised using the N terminal of LYN corresponding to a region with amino acids DPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSF |
| Purity/Format | Affinity purified |
| Blocking Peptide | LYN Blocking Peptide |
| Description | Rabbit polyclonal LYN antibody raised against the N terminal of LYN |
| Gene | LYN |
| Supplier Page | Shop |