Name | RNF207 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2537 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse |
Antigen | RNF207 antibody was raised using the N terminal of RNF207 corresponding to a region with amino acids CLLDCFHDFCAGCLRGRATDGRLTCPLCQHQTVLKGPSGLPPVDRLLQFL |
Purity/Format | Affinity purified |
Blocking Peptide | RNF207 Blocking Peptide |
Description | Rabbit polyclonal RNF207 antibody raised against the N terminal of RNF207 |
Gene | RNF207 |
Supplier Page | Shop |