| Name | BLVRB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2179 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | BLVRB antibody was raised using the middle region of BLVRB corresponding to a region with amino acids GLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTD |
| Purity/Format | Affinity purified |
| Blocking Peptide | BLVRB Blocking Peptide |
| Description | Rabbit polyclonal BLVRB antibody raised against the middle region of BLVRB |
| Gene | BLVRB |
| Supplier Page | Shop |