Anti-EME1 antibody
| Name | Anti-EME1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab89969 |
| Prices | $376.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 504-553 (YPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEGVTSTSRRIGPELSRR I) of Human EME1 (NP_689676) |
| Description | Rabbit Polyclonal |
| Gene | EME1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-EME1 antibody (ab89969) at 1 µg/ml + HT1080 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution