Anti-ECHDC2 antibody
| Name | Anti-ECHDC2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab90044 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Pig |
| Antigen | Synthetic peptide corresponding to a region from internal sequence amino acids 144-193 ( QRLPRCLGVALAKELIFTGRRLSGTEAHVLGLVNHAVAQNEEGDAAYQRA ) of Human ECHDC2 (NP_060751) |
| Description | Rabbit Polyclonal |
| Gene | ECHDC2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ECHDC2 antibody (ab90044) at 1 µg/ml (5% skim milk / PBS buffer) + THP1 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution